ASCC3L1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87044
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of ASCC3L1. Peptide sequence: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for ASCC3L1 Antibody - BSA Free
Western Blot: ASCC3L1 Antibody [NBP2-87044]
Western Blot: ASCC3L1 Antibody [NBP2-87044] - Host: Rabbit. Target Name: SNRNP200. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 1ug/mlWestern Blot: ASCC3L1 Antibody [NBP2-87044]
Western Blot: ASCC3L1 Antibody [NBP2-87044] - WB Suggested Anti-SNRNP200 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole CellWestern Blot: ASCC3L1 Antibody [NBP2-87044]
Western Blot: ASCC3L1 Antibody [NBP2-87044] - Host: Rabbit. Target Name: SNRNP200. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/mlWestern Blot: ASCC3L1 Antibody [NBP2-87044]
Western Blot: ASCC3L1 Antibody [NBP2-87044] - Host: Rabbit. Target Name: SNRNP200. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/mlApplications for ASCC3L1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ASCC3L1
Alternate Names
ASCC3L1, BRR2, BRR2 homolog, FLJ11521, HELIC2, KIAA0788, RP33, small nuclear ribonucleoprotein 200kDa (U5), U5 small nuclear ribonucleoprotein 200 kDa helicase, U5 snRNP-specific 200 kDa protein, U5-200KD
Gene Symbol
SNRNP200
Additional ASCC3L1 Products
Product Documents for ASCC3L1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ASCC3L1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ASCC3L1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ASCC3L1 Antibody - BSA Free and earn rewards!
Have you used ASCC3L1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...