ASZ1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57071

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASZ1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ASZ1 (ankyrin repeat, SAM and basic leucine zipper domain containing 1) The peptide sequence was selected from the middle region of ASZ1. Peptide sequence GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ASZ1 Antibody - BSA Free

Western Blot: ASZ1 Antibody [NBP1-57071]

Western Blot: ASZ1 Antibody [NBP1-57071]

Western Blot: ASZ1 Antibody [NBP1-57071] - THP-1 tissue lysate at a concentration of 1ug/ml.

Applications for ASZ1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASZ1

ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.ASZ1 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process.ASZ1 is required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons.ASZ1 may act by mediating protein-protein interactions during germ cell maturation.

Alternate Names

ALP1Germ cell-specific ankyrin, SAM and basic leucine zipper domain-containingprotein, ANKL14933400N19Rik, ankyrin repeat, SAM and basic leucine zipper domain containing 1, ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1, ankyrin-like 1, Ankyrin-like protein 1, CT1.19, GASZC7orf7, MGC26634, Orf3

Gene Symbol

ASZ1

UniProt

Q8WWH4 (Human)

Additional ASZ1 Products

Product Documents for ASZ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASZ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASZ1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASZ1 Antibody - BSA Free and earn rewards!

Have you used ASZ1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies