ATF6 beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84474

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATF6 beta. Peptide sequence: FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATF6 beta Antibody - BSA Free

Western Blot: ATF6 beta Antibody [NBP2-84474]

Western Blot: ATF6 beta Antibody [NBP2-84474]

Western Blot: ATF6 beta Antibody [NBP2-84474] - WB Suggested Anti-CREBL1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Muscle

Applications for ATF6 beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATF6 beta

ATF-6 is a member of the basic-leucine zipper family of transcription factors. Endoplasmic reticulum stress causes cleavage of transmembrane ATF-6 and transclocation of active ATF-6 to the nucleus. Soluble ATF-6 can exist as either an ATF-6beta homodimer or an ATF-6alpha/beta heterodimer. Binding of the ATF-6beta homodimer or ATF-6alpha/beta heterodimer to the nuclear transcription factor Y C (NF-YC) induces ER chaperone transcription. Human ATF-6beta maps to 1q22-q23 gene locus.

Alternate Names

activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta, ATF6-beta, cAMP response element-binding protein-related protein, cAMP responsive element binding protein-like 1, CREBL1CREB-RP, Creb-related protein, Creb-rp, cyclic AMP-dependent transcription factor ATF-6 beta, FLJ10066, G13cAMP-responsive element-binding protein-like 1, Protein G13

Gene Symbol

ATF6B

Additional ATF6 beta Products

Product Documents for ATF6 beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATF6 beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATF6 beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATF6 beta Antibody - BSA Free and earn rewards!

Have you used ATF6 beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...