ATP6V1G2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79685

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human ATP6V1G2The immunogen for this antibody is ATP6V1G2. Peptide sequence NLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATP6V1G2 Antibody - BSA Free

Western Blot: ATP6V1G2 Antibody [NBP1-79685]

Western Blot: ATP6V1G2 Antibody [NBP1-79685]

Western Blot: ATP6V1G2 Antibody [NBP1-79685] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for ATP6V1G2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1G2

ATP6V1G2 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2, Em:AC004181.3, subunit G2, vacuolar ATP synthase subunit G 2, vacuolar proton pump G subunit 2, Vacuolar proton pump subunit G 2, V-ATPase 13 kDa subunit 2, V-ATPase subunit G 2, Vma10, V-type proton ATPase subunit G 2

Gene Symbol

ATP6V1G2

Additional ATP6V1G2 Products

Product Documents for ATP6V1G2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V1G2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V1G2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V1G2 Antibody - BSA Free and earn rewards!

Have you used ATP6V1G2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...