B3GALT6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69627

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all B3GALT6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected from the N terminal of B3GALT6. Peptide sequence EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for B3GALT6 Antibody - BSA Free

Western Blot: B3GALT6 Antibody [NBP1-69627]

Western Blot: B3GALT6 Antibody [NBP1-69627]

Western Blot: B3GALT6 Antibody [NBP1-69627] - This Anti-B3GALT6 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Applications for B3GALT6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: B3GALT6

B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Alternate Names

beta-1,3-galactosyltransferase 6, Beta-1,3-GalTase 6, beta3GalT6, beta3Gal-T6, EC 2.4.1.134, Galactosyltransferase II, Galactosylxylosylprotein 3-beta-galactosyltransferase, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6

Gene Symbol

B3GALT6

UniProt

Q96L58 (Human)

Additional B3GALT6 Products

Product Documents for B3GALT6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for B3GALT6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for B3GALT6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review B3GALT6 Antibody - BSA Free and earn rewards!

Have you used B3GALT6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies