B3GALTL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62376

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all B3GALTL Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to B3GALTL(beta 1,3-galactosyltransferase-like) The peptide sequence was selected form the middle region of B3GALTL. Peptide sequence DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for B3GALTL Antibody - BSA Free

Western Blot: B3GALTL Antibody [NBP1-62376]

Western Blot: B3GALTL Antibody [NBP1-62376]

Western Blot: B3GALTL Antibody [NBP1-62376] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

Applications for B3GALTL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: B3GALTL

B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin (see THBS1; MIM 188060) type-1 repeats (TSRs) of many biologically important proteins. Biosynthesis of glucosyl-beta-1,3-fucose-O- is initiated by protein O-fucosyltransferase-2 (POFUT2; MIM 610249), which attaches the fucosyl residue to a serine or threonine within the TSR. B3GALTL subsequently transfers the glucose onto TSR-fucose (Hess et al., 2008 [PubMed 18199743]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 DN999521.1 41-310 271-457 AB101481.1 161-347 458-467 DN999521.1 499-508 468-1217 AB101481.1 358-1107 1218-1279 DA290408.1 515-576 1280-1607 AB101481.1 1170-1497 1608-2495 AY190526.1 1498-2385 2496-3459 AY190526.1 2387-3350 3460-4071 AV728071.1 87-698 4072-4221 AA769548.1 1-150 c

Long Name

beta 1,3-Galactosyltransferase-like

Alternate Names

B3Glc-T, B3GLCT, B3GTL, Beta3Glc-T, Gal-T

Gene Symbol

B3GLCT

OMIM

NP_919299 (Human)

UniProt

Q6Y288 (Human)

Additional B3GALTL Products

Product Documents for B3GALTL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for B3GALTL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for B3GALTL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review B3GALTL Antibody - BSA Free and earn rewards!

Have you used B3GALTL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies