bcl10-interacting CARD protein Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92715

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all bcl10-interacting CARD protein Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3). MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for bcl10-interacting CARD protein Antibody - Azide and BSA Free

Western Blot: bcl10-interacting CARD protein AntibodyAzide and BSA Free [NBP2-92715]

Western Blot: bcl10-interacting CARD protein AntibodyAzide and BSA Free [NBP2-92715]

Western Blot: bcl10-interacting CARD protein Antibody [NBP2-92715] - Analysis of extracts of various cell lines, using bcl10-interacting CARD protein.Exposure time: 90s.

Applications for bcl10-interacting CARD protein Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: bcl10-interacting CARD protein

C9orf89 plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit thephosphorylation of BCL10 in a CARD-dependent manner

Alternate Names

bA370F5.1, bcl10-interacting CARD protein, Bcl10-interacting protein with CARD, BinCARD, chromosome 9 open reading frame 89, MGC110898, MGC11115

Gene Symbol

CARD19

Additional bcl10-interacting CARD protein Products

Product Documents for bcl10-interacting CARD protein Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for bcl10-interacting CARD protein Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for bcl10-interacting CARD protein Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review bcl10-interacting CARD protein Antibody - Azide and BSA Free and earn rewards!

Have you used bcl10-interacting CARD protein Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies