Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10595

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse B3gnt1 (NP_780592). Peptide sequence RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free

Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody [NBP3-10595]

Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody [NBP3-10595]

Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody [NBP3-10595] - Western blot analysis of Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 in Mouse Testis lysates. Antibody dilution at 1.0ug/ml

Applications for Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1

B3GNT1 encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. [provided by RefSeq]

Long Name

beta-1,4-Glucuronyltransferase 1

Alternate Names

B3GNT1, B3GN-T1, beta-1,3-N-acetylglucosaminyltransferase bGnT-6, BETA3GNTI, EC 2.4.1.149, i-beta-1,3-N-acetylglucosaminyltransferase, IGAT, iGNT, MDDGA13, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, Poly-N-acetyllactosamine extension enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6

Gene Symbol

B4GAT1

Additional Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Products

Product Documents for Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free and earn rewards!

Have you used Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies