beta-Arrestin 1 Antibody (F7C2)

Novus Biologicals | Catalog # NBP3-15335

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # F7C2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta-Arrestin 1 (P49407). MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for beta-Arrestin 1 Antibody (F7C2)

Western Blot: beta-Arrestin 1 Antibody (F7C2) [NBP3-15335]

Western Blot: beta-Arrestin 1 Antibody (F7C2) [NBP3-15335]

Western Blot: beta-Arrestin 1 Antibody (F7C2) [NBP3-15335] - Western blot analysis of extracts of various cell lines, using beta-Arrestin 1 Rabbit mAb (NBP3-15335) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for beta-Arrestin 1 Antibody (F7C2)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: beta-Arrestin 1

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization ofG-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones,neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in thebeta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the centralnervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin systemis believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcriptsencoding different isoforms of arrestin beta 1 have been described, however, their exact functions are not known.(provided by RefSeq)

Alternate Names

ARR1, ARRB1, betaArrestin 1

Gene Symbol

ARRB1

Additional beta-Arrestin 1 Products

Product Documents for beta-Arrestin 1 Antibody (F7C2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for beta-Arrestin 1 Antibody (F7C2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta-Arrestin 1 Antibody (F7C2)

There are currently no reviews for this product. Be the first to review beta-Arrestin 1 Antibody (F7C2) and earn rewards!

Have you used beta-Arrestin 1 Antibody (F7C2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

MAPK Signaling: Oxidative Stress Pathway
MAPK Signaling: Oxidative Stress Pathway Thumbnail