BEX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84506

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BEX4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BEX4. Peptide sequence: PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BEX4 Antibody - BSA Free

Western Blot: BEX4 Antibody [NBP2-84506]

Western Blot: BEX4 Antibody [NBP2-84506]

Western Blot: BEX4 Antibody [NBP2-84506] - WB Suggested Anti-BEX4 Antibody. Titration: 1.0 ug/ml. Positive Control: HCT15 Whole Cell
Western Blot: BEX4 Antibody [NBP2-84506]

Western Blot: BEX4 Antibody [NBP2-84506]

Western Blot: BEX4 Antibody [NBP2-84506] - Host: Rabbit. Target: BEX4. Positive control (+): Human Liver (LI). Negative control (-): HeLa Cell Lysate (HL). Antibody concentration: 1ug/ml

Applications for BEX4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BEX4

Bex proteins are expressed from a family of "brain expressed X-linked genes". SUBCELLULAR LOCATION: Nucleus, Cytoplasm

Alternate Names

BEX family member 4, BEX1-like protein 1, BEXL1, brain expressed X-linked-like 1, brain expressed, X-linked 4, Brain-expressed X-linked protein 4, FLJ10097, NADE3, Nerve growth factor receptor-associated protein 3, protein BEX4

Gene Symbol

BEX4

Additional BEX4 Products

Product Documents for BEX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BEX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BEX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BEX4 Antibody - BSA Free and earn rewards!

Have you used BEX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies