BRN3B/POU4F2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86585

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BRN3B/POU4F2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BRN3B/POU4F2. Peptide sequence: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BRN3B/POU4F2 Antibody - BSA Free

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585]

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585]

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585] - Host: Rabbit. Target Name: POU4F2. Sample Tissue: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585]

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585]

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585] - Host: Rabbit. Target Name: POU4F2. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml

Applications for BRN3B/POU4F2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRN3B/POU4F2

POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.(supplied by OMIM)

Alternate Names

BRN3.2, BRN3B, Brn-3b, POU class 4 homeobox 2, POU domain, class 4, transcription factor 2

Gene Symbol

POU4F2

Additional BRN3B/POU4F2 Products

Product Documents for BRN3B/POU4F2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRN3B/POU4F2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRN3B/POU4F2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRN3B/POU4F2 Antibody - BSA Free and earn rewards!

Have you used BRN3B/POU4F2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies