Calpain 6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84585

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Calpain 6. Peptide sequence: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Calpain 6 Antibody - BSA Free

Western Blot: Calpain 6 Antibody [NBP2-84585]

Western Blot: Calpain 6 Antibody [NBP2-84585]

Western Blot: Calpain 6 Antibody [NBP2-84585] - Host: Rabbit. Target Name: CAPN6. Sample Tissue: Human A172 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for Calpain 6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calpain 6

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins areheterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses acysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated inneurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The proteinencoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to thecalmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to beproteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promotingangiogenesis. (provided by RefSeq)

Alternate Names

calpain 6, calpain-6, Calpain-like protease X-linked, Calpamodulin, CalpMCALPM, CANPXcalpamodulin, CAPNX, DJ914P14.1, EC 3.4.22

Gene Symbol

CAPN6

Additional Calpain 6 Products

Product Documents for Calpain 6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calpain 6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calpain 6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calpain 6 Antibody - BSA Free and earn rewards!

Have you used Calpain 6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...