Carbonic Anhydrase I/CA1 Antibody (0G10F8)

Novus Biologicals | Catalog # NBP3-16404

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0G10F8 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase I/CA1 (NP_001729.1). KVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbonic Anhydrase I/CA1 Antibody (0G10F8)

Western Blot: Carbonic Anhydrase I/CA1 Antibody (0G10F8) [NBP3-16404]

Western Blot: Carbonic Anhydrase I/CA1 Antibody (0G10F8) [NBP3-16404]

Western Blot: Carbonic Anhydrase I/CA1 Antibody (0G10F8) [NBP3-16404] - Western blot analysis of extracts of various cell lines, using Carbonic Anhydrase I/CA1 (CA1) Rabbit mAb (NBP3-16404) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for Carbonic Anhydrase I/CA1 Antibody (0G10F8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase I/CA1

Carbonic anhydrase performs an important role in respiration by facilitating transfer of CO2. Carbonic Anhydrase I (CAI) is a single polypeptide chain metalloenzyme of molecular weight 29 kDa. It is present mainly in erythrocytes at a concentration of about 12 mg per gram haemoglobin. Its main enzyme function is to catalyse the reversible hydration of carbon dioxide. It also catalyses the hydrolysis of certain esters. The twelve active CA isozymes are thought to regulate a variety of cellular functions including several processes in the reproductive systems. A mutational deficiency has been described but patients exhibit no adverse chemical symptoms. Red cell CAI levels are decreased in patients with thyrotoxicosis.

Alternate Names

CA1

Gene Symbol

CA1

Additional Carbonic Anhydrase I/CA1 Products

Product Documents for Carbonic Anhydrase I/CA1 Antibody (0G10F8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbonic Anhydrase I/CA1 Antibody (0G10F8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbonic Anhydrase I/CA1 Antibody (0G10F8)

There are currently no reviews for this product. Be the first to review Carbonic Anhydrase I/CA1 Antibody (0G10F8) and earn rewards!

Have you used Carbonic Anhydrase I/CA1 Antibody (0G10F8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...