CAT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90066

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CAT1 Antibody - BSA Free

CAT1 Antibody - BSA Free Western Blot: CAT1 Antibody - BSA Free [NBP1-90066]

Western Blot: CAT1 Antibody - BSA Free [NBP1-90066]

Analysis in human cell line SCLC-21H.

Applications for CAT1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

Reported in scientific literature (PMID:29094484)

Western Blot

0.04 - 0.4 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CAT1/SLC7A1

High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor

Long Name

Cationic 1/Solute Carrier Family 7 Member 1

Alternate Names

ATRC1, HCAT1, REC1L, SLC7A1

Gene Symbol

SLC7A1

Additional CAT1/SLC7A1 Products

Product Documents for CAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CAT1 Antibody - BSA Free

Customer Reviews for CAT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CAT1 Antibody - BSA Free and earn rewards!

Have you used CAT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CAT1 Antibody - BSA Free

Showing  1 - 3 的 3 FAQs Showing All
  • Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?

    A: There are currently no product specific references associated with either one of these antibodies.

  • Q: What is the amino acid sequence and species of the immunogen?

    A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.

  • Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?

    A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?

    A: There are currently no product specific references associated with either one of these antibodies.

  • Q: What is the amino acid sequence and species of the immunogen?

    A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.

  • Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?

    A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?

    A: There are currently no product specific references associated with either one of these antibodies.

  • Q: What is the amino acid sequence and species of the immunogen?

    A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.

  • Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?

    A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 3 的 3 FAQs Showing All
View all FAQs for Antibodies
Loading...