CD1e Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10790

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CD1e Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CD1e. Peptide sequence AHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit CD1e Antibody - BSA Free (NBP3-10790) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD1e Antibody - BSA Free

Western Blot: CD1e Antibody [NBP3-10790]

Western Blot: CD1e Antibody [NBP3-10790]

Western Blot: CD1e Antibody [NBP3-10790] - Western blot analysis of CD1e in Fetal Lung lysates. Antibody dilution at 1.0ug/ml

Applications for CD1e Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD1e

The CD1E gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to themajor histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteinsmediate the presentation of

Alternate Names

CD1-alpha-3, CD1e, CDIEL, R2G1

Gene Symbol

CD1E

Additional CD1e Products

Product Documents for CD1e Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD1e Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD1e Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD1e Antibody - BSA Free and earn rewards!

Have you used CD1e Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies