CD300c Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-84432PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD300C.

Source: E. coli

Amino Acid Sequence: PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84432.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-84432PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CD300c

CD300C - CD300C antigen

Long Name

CD300 Antigen-Like Family Member C

Alternate Names

CLM-6, CLM6, CMRF35, IGSF16

Gene Symbol

CD300C

Additional CD300c Products

Product Documents for CD300c Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD300c Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for CD300c Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review CD300c Recombinant Protein Antigen and earn rewards!

Have you used CD300c Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for CD300c Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?

    A:

    A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:

    https://www.uniprot.org/uniprot/Q08708#sequences

    We can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...