CENTB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84652

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CENTB1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CENTB1. Peptide sequence: IVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CENTB1 Antibody - BSA Free

Western Blot: CENTB1 Antibody [NBP2-84652]

Western Blot: CENTB1 Antibody [NBP2-84652]

Western Blot: CENTB1 Antibody [NBP2-84652] - Host: Rabbit. Target Name: ACAP1. Sample Tissue: Human RPMI 8226 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for CENTB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CENTB1

Potential GTPase-activating protein for the ADP ribosylation factor family, contains Contains 3 ANK repeats, 1 Arf GAP domain and 1 PH domain.

Alternate Names

Arf GAP with coiled coil, ANK repeat and PH domains 1, arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1, centaurin, beta 1, Centaurin-beta-1, CENTB1cnt-b1, Cnt-b1, KIAA0050centaurin-beta-1

Gene Symbol

ACAP1

Additional CENTB1 Products

Product Documents for CENTB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CENTB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CENTB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CENTB1 Antibody - BSA Free and earn rewards!

Have you used CENTB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies