CHES1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84672

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CHES1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHES1. Peptide sequence: HKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHES1 Antibody - BSA Free

Western Blot: CHES1 Antibody [NBP2-84672]

Western Blot: CHES1 Antibody [NBP2-84672]

Western Blot: CHES1 Antibody [NBP2-84672] - WB Suggested Anti-FOXN3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Hela cell lysate

Applications for CHES1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHES1

The CHES1 gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNAdamage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpointmutations including mec1, rad9, rad

Alternate Names

C14orf116, Checkpoint suppressor 1PRO1635, CHES1forkhead box protein N3, chromosome 14 open reading frame 116, forkhead box N3

Gene Symbol

FOXN3

Additional CHES1 Products

Product Documents for CHES1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHES1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHES1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHES1 Antibody - BSA Free and earn rewards!

Have you used CHES1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies