CHMP4C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87185

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse CHMP4C. Peptide sequence: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHMP4C Antibody - BSA Free

Western Blot: CHMP4C Antibody [NBP2-87185]

Western Blot: CHMP4C Antibody [NBP2-87185]

Western Blot: CHMP4C Antibody [NBP2-87185] - Host: Rabbit. Target Name: Chmp4c. Sample Type: Mouse Liver lysates. Antibody Dilution: 1.0ug/ml
Western Blot: CHMP4C Antibody [NBP2-87185]

Western Blot: CHMP4C Antibody [NBP2-87185]

Western Blot: CHMP4C Antibody [NBP2-87185] - Host: Rabbit. Target Name: CHMP4C. Sample Tissue: Mouse Mouse Spleen. Antibody Dilution: 1ug/ml

Applications for CHMP4C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP4C

CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM]

Alternate Names

charged multivesicular body protein 4c, CHMP4c, chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7-3, hVps32-3, MGC22825, Shax3, SNF7 homolog associated with Alix 3, Snf7 homologue associated with Alix 3, SNF7-3, Vacuolar protein sorting-associated protein 32-3, vps32-3, VPS32C

Gene Symbol

CHMP4C

Additional CHMP4C Products

Product Documents for CHMP4C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHMP4C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHMP4C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHMP4C Antibody - BSA Free and earn rewards!

Have you used CHMP4C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...