CHRFAM7A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80090

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHRFAM7A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human CHRFAM7A. Peptide Sequence: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHRFAM7A Antibody - BSA Free

Western Blot: CHRFAM7A Antibody [NBP1-80090]

Western Blot: CHRFAM7A Antibody [NBP1-80090]

Western Blot: CHRFAM7A Antibody [NBP1-80090] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: CHRFAM7A Antibody [NBP1-80090]

Western Blot: CHRFAM7A Antibody [NBP1-80090]

Western Blot: CHRFAM7A Antibody [NBP1-80090] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: CHRFAM7A Antibody [NBP1-80090]

Western Blot: CHRFAM7A Antibody [NBP1-80090]

Western Blot: CHRFAM7A Antibody [NBP1-80090] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml CHRFAM7A is supported by BioGPS gene expression data to be expressed in 721_B.

Applications for CHRFAM7A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHRFAM7A

CHRFAM7A is a gene that codes for a multi-pass membrane protein expressed in the hippocampus that is 412 amino acids long and weighs approximately 46 kDa. Current studies are being done on diseases and disorders related to this gene including neuronitis, Alzheimer's disease, juvenile myoclonic epilepsy, bipolar affective disorder, schizoaffective disorder, pharyngitis, and dementia. CHRFAM7A has been shown to have involvement in pathways such as the SIDS susceptibility pathway.

Alternate Names

CHRNA7, CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion, CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion, CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid, CHRNA7-FAM7A fusion protein, D-10alpha-7 nicotinic cholinergic receptor subunit, MGC120482, MGC120483

Gene Symbol

CHRFAM7A

UniProt

NP_683709 (Human)

Additional CHRFAM7A Products

Product Documents for CHRFAM7A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHRFAM7A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHRFAM7A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHRFAM7A Antibody - BSA Free and earn rewards!

Have you used CHRFAM7A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies