Chromogranin B Antibody (5N6T1)
Novus Biologicals | Catalog # NBP3-16206
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5N6T1 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060). EEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Chromogranin B Antibody (5N6T1)
Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206]
Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206] - Western blot analysis of extracts of various cell lines, using Chromogranin B antibody (NBP3-16206) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206]
Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206] - Western blot analysis of extracts of Mouse brain cells, using Chromogranin B antibody (NBP3-16206) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Applications for Chromogranin B Antibody (5N6T1)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Chromogranin B
Alternate Names
CHGB, SCG1, Secretogranin I
Gene Symbol
CHGB
Additional Chromogranin B Products
Product Documents for Chromogranin B Antibody (5N6T1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Chromogranin B Antibody (5N6T1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Chromogranin B Antibody (5N6T1)
There are currently no reviews for this product. Be the first to review Chromogranin B Antibody (5N6T1) and earn rewards!
Have you used Chromogranin B Antibody (5N6T1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...