Chromogranin C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91628

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards SCG2. Peptide sequence DIDRPDMFQSKTLSKGGYPKAPGRGMMEALPDGLSVEDILNVLGMENVAN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Chromogranin C Antibody - BSA Free

Western Blot: Chromogranin C Antibody [NBP1-91628]

Western Blot: Chromogranin C Antibody [NBP1-91628]

Western Blot: Chromogranin C Antibody [NBP1-91628] - Rat Liver lysate, concentration 1 ug/ml.

Applications for Chromogranin C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chromogranin C

Chromogranin C is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. [provided by RefSeq]

Alternate Names

CHCG, Chromogranin-C, EM66, SCG2, secretogranin IICHGCchromogranin-C, secretoneurin, SgIIsecretogranin-2, SN

Gene Symbol

SCG2

UniProt

Additional Chromogranin C Products

Product Documents for Chromogranin C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chromogranin C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chromogranin C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chromogranin C Antibody - BSA Free and earn rewards!

Have you used Chromogranin C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Chromogranin C Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628

    A: The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...