CHST8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87189

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CHST8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N region of human CHST8. Peptide sequence: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHST8 Antibody - BSA Free

Western Blot: CHST8 Antibody [NBP2-87189]

Western Blot: CHST8 Antibody [NBP2-87189]

Western Blot: CHST8 Antibody [NBP2-87189] - Host: Rabbit. Target Name: CHST8. Sample Tissue: Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for CHST8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHST8

Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]).[supplied by OMIM]

Alternate Names

carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8, carbohydrate sulfotransferase 8, EC 2.8.2.-, GalNAc-4-O-sulfotransferase 1, GalNAc4ST, GALNAC4ST1, GalNAc-4-ST1, galNAc4ST-1, N-acetylgalactosamine-4-O-sulfotransferase 1

Gene Symbol

CHST8

Additional CHST8 Products

Product Documents for CHST8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHST8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHST8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHST8 Antibody - BSA Free and earn rewards!

Have you used CHST8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies