CHT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86604

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CHT1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CHT1. Peptide sequence: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHT1 Antibody - BSA Free

Western Blot: CHT1 Antibody [NBP2-86604]

Western Blot: CHT1 Antibody [NBP2-86604]

Western Blot: CHT1 Antibody [NBP2-86604] - Host: Rabbit. Target Name: SLC5A7. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for CHT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHT1

Acetylcholine functions as a neurotransmitter in both the central and peripheral nervous systems of all vertebates, and is the principle neurotransmitter used at the neuromuscular junction. Presynaptic synthesis of acetylcholine requires a steady supply of choline, which is acquired by a plasma membrane high affinity choline transporter (CHT). CHT1 is a plasmalemmal transporter that carries choline to acetylcholine-synthesizing neurons.

CHT1 antibodies are useful tools for neruology and cell signaling studies.

Alternate Names

CHT, CHT1MGC126299, hCHT, Hemicholinium-3-sensitive choline transporter, high affinity choline transporter 1, high affinity choline transporter; hemicholinium-3-sensitive cholinetransporter, MGC126300, solute carrier family 5 (choline transporter), member 7, Solute carrier family 5 member 7

Gene Symbol

SLC5A7

Additional CHT1 Products

Product Documents for CHT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHT1 Antibody - BSA Free and earn rewards!

Have you used CHT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies