CKIP-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56986

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PLEKHO1 (pleckstrin homology domain containing, family O member 1) The peptide sequence was selected from the N terminal of PLEKHO1. Peptide sequence MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CKIP-1 Antibody - BSA Free

Western Blot: CKIP-1 Antibody [NBP1-56986]

Western Blot: CKIP-1 Antibody [NBP1-56986]

Western Blot: CKIP-1 Antibody [NBP1-56986] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Applications for CKIP-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CKIP-1

PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.

Alternate Names

2810052M02Rik, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CK2 interacting protein 1; HQ0024c protein, CK2-interacting protein 1, CKIP1, CKIP-1PH domain-containing family O member 1, JBP, OC120, Osteoclast maturation-associated gene 120 protein, pleckstrin homology domain containing, family O member 1, pleckstrin homology domain-containing family O member 1

Gene Symbol

PLEKHO1

UniProt

Additional CKIP-1 Products

Product Documents for CKIP-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CKIP-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CKIP-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CKIP-1 Antibody - BSA Free and earn rewards!

Have you used CKIP-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...