Claudin-18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60010

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Canine

Cited:

Human

Applications

Validated:

Western Blot, Surface Plasmon Resonance (SPR)

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the C terminal of CLDN18. Peptide sequence PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Canine reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Claudin-18 Antibody - BSA Free

Western Blot: Claudin-18 Antibody [NBP1-60010]

Western Blot: Claudin-18 Antibody [NBP1-60010]

Western Blot: Claudin-18 Antibody [NBP1-60010] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Western Blot: Claudin-18 Antibody [NBP1-60010]

Western Blot: Claudin-18 Antibody [NBP1-60010]

Western Blot: Claudin-18 Antibody [NBP1-60010] - Tissue:Jurkat cells. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.
Western Blot: Claudin-18 Antibody [NBP1-60010]

Western Blot: Claudin-18 Antibody [NBP1-60010]

Western Blot: Claudin-18 Antibody [NBP1-60010] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for Claudin-18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-60010 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-18

CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001).[supplied by OMIM].

Alternate Names

Claudin18, CLDN18, SFTA5, SFTPJ

Gene Symbol

CLDN18

UniProt

Additional Claudin-18 Products

Product Documents for Claudin-18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Claudin-18 Antibody - BSA Free

Customer Reviews for Claudin-18 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Claudin-18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 的 1 review Showing All
Filter By:
  • Claudin-18 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Adult lung
    Species: Canine
    Verified Customer | Posted 05/11/2022
    CLDN18 in canine lung tissue
    CLDN18 antibody used at 1:50 concentration in casein in PBS and left at 4C overnight on paraffin embedded canine bladder tissue. HIER was performed in Citrate buffer, pH6.
    Claudin-18 Antibody - BSA Free NBP1-60010

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

FAQs for Claudin-18 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: Our customer purchased NBP1-60010 for IHC. She tested as following way: Sample: human stoma cancer tissue, Dilution: 1:100 incubation, overnight used vector ABC kit. But, she got very weak stain result. So, she asked the positive tissue for this item. Could you let me know?

    A:

    The Human Protein Atlas shows where tissues have stained positive using another company's antibodies for Claudin 18 (http://www.proteinatlas.org/ENSG00000066405). I would recommend a tissue that has been shown to stain positive from this list as a positive control. This protein is also highly expressed in the epithelial cells of the GI-tract.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...