Claudin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82696

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Claudin-2. Peptide sequence: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Claudin-2 Antibody - BSA Free

Western Blot: Claudin-2 Antibody [NBP2-82696]

Western Blot: Claudin-2 Antibody [NBP2-82696]

Western Blot: Claudin-2 Antibody [NBP2-82696] - Host: Rabbit. Target Name: CLDN2. Sample Tissue: Human MCF7. Antibody Dilution: 1.0ug/ml

Applications for Claudin-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-2

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteinsare known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Emerging evidence suggests that the Claudin family of proteins regulates transport through tight junctions via differential discrimination for solute size and charge. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions.

Alternate Names

Claudin2, CLDN2, SP82

Gene Symbol

CLDN2

Additional Claudin-2 Products

Product Documents for Claudin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Claudin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Claudin-2 Antibody - BSA Free and earn rewards!

Have you used Claudin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies