CNTFR Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68943

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CNTFR Antibody - BSA Free

Western Blot: CNTFR Antibody [NBP1-68943]

Western Blot: CNTFR Antibody [NBP1-68943]

Western Blot: CNTFR Antibody [NBP1-68943] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CNTFR Antibody [NBP1-68943]

Western Blot: CNTFR Antibody [NBP1-68943]

Western Blot: CNTFR Antibody [NBP1-68943] - A549, H441.

Applications for CNTFR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CNTFR

This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.

Alternate Names

ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774

Gene Symbol

CNTFR

UniProt

Additional CNTFR Products

Product Documents for CNTFR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CNTFR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CNTFR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CNTFR Antibody - BSA Free and earn rewards!

Have you used CNTFR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...