Collagen X alpha 1 Antibody (0F5Q9)

Novus Biologicals | Catalog # NBP3-15419

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0F5Q9 expressed in HEK293
View all Collagen X alpha 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X alpha 1 (Q03692). HSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Collagen X alpha 1 Antibody (0F5Q9)

Western Blot: Collagen X alpha 1 Antibody (0F5Q9) [NBP3-15419]

Western Blot: Collagen X alpha 1 Antibody (0F5Q9) [NBP3-15419]

Western Blot: Collagen X alpha 1 Antibody (0F5Q9) [NBP3-15419] - Western blot analysis of extracts of various cell lines, using Collagen X alpha 1 Rabbit mAb (NBP3-15419) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Collagen X alpha 1 Antibody (0F5Q9)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Collagen X alpha 1

Alternate Names

COL10A1, Collagen Alpha-1(X) Chain, Collagen X, Alpha-1 Polypeptide, Schmid Metaphyseal Chondrodysplasia

Gene Symbol

COL10A1

Additional Collagen X alpha 1 Products

Product Documents for Collagen X alpha 1 Antibody (0F5Q9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Collagen X alpha 1 Antibody (0F5Q9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Collagen X alpha 1 Antibody (0F5Q9)

There are currently no reviews for this product. Be the first to review Collagen X alpha 1 Antibody (0F5Q9) and earn rewards!

Have you used Collagen X alpha 1 Antibody (0F5Q9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies