COP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83979

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of COP1. Peptide sequence: MSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGTSQTKKQPW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for COP1 Antibody - BSA Free

Western Blot: COP1 Antibody [NBP2-83979]

Western Blot: COP1 Antibody [NBP2-83979]

Western Blot: COP1 Antibody [NBP2-83979] - WB Suggested Anti-Rfwd2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Thymus

Applications for COP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COP1

COP1 is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. It is directly involved in p53 ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. It ubiquitinates p53 independently of MDM2 or RCHY1. It probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, where the ubiquitin ligase activity is mediated by RBX1.

Alternate Names

Constitutive photomorphogenesis protein 1 homolog, constitutive photomorphogenic protein (COP1), COP1RNF200FLJ10416, E3 ubiquitin-protein ligase RFWD2, EC 6.3.2.-, hCOP1, putative ubiquitin ligase COP1, ring finger and WD repeat domain 2, RING finger and WD repeat domain protein 2, RING finger protein 200

Gene Symbol

COP1

Additional COP1 Products

Product Documents for COP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COP1 Antibody - BSA Free and earn rewards!

Have you used COP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...