COPS6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79752

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human COPS6The immunogen for this antibody is COPS6. Peptide sequence DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COPS6 Antibody - BSA Free

Western Blot: COPS6 Antibody [NBP1-79752]

Western Blot: COPS6 Antibody [NBP1-79752]

Western Blot: COPS6 Antibody [NBP1-79752] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: COPS6 Antibody [NBP1-79752]

Western Blot: COPS6 Antibody [NBP1-79752]

Western Blot: COPS6 Antibody [NBP1-79752] - Sample Type: 1. ABAE cells 2. CHO-IR cells Primary Dilution: 1:200 Secondary antibody: HRP conjugated anti-rabbit Image Submitted By: Dr. Elah Pick University of Haifa at Oranim.

Applications for COPS6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COPS6

COPS6 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq]

Alternate Names

BMP2B, BMP2B1, BMP4, COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis), COP9 signalosome complex subunit 6, CSN6COP9 subunit 6 (MOV34 homolog, 34 kD), H_NH0506M12.12, hVIP, JAB1-containing signalosome subunit 6, MOFC11, MOV34 homolog, MOV34 homolog, 34 kD, MOV34-34KD, SGN6, Signalosome subunit 6, Vpr-interacting protein

Gene Symbol

COPS6

Additional COPS6 Products

Product Documents for COPS6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COPS6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COPS6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COPS6 Antibody - BSA Free and earn rewards!

Have you used COPS6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...