COPZ1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10793

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human COPZ1 (NP_001258665). Peptide sequence VKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for COPZ1 Antibody - BSA Free

Western Blot: COPZ1 Antibody [NBP3-10793]

Western Blot: COPZ1 Antibody [NBP3-10793]

Western Blot: COPZ1 Antibody [NBP3-10793] - Western blot analysis of COPZ1 in Human Breast Tumor lysates. Antibody dilution at 1ug/ml

Applications for COPZ1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COPZ1

Membrane and vesicular trafficking in the early secretory pathway are mediated by non-Clathrin COP (coat protein) I-coated vesicles. COPI-coated vesicles mediate retrograde transport from the Golgi back to the ER and intra-Golgi transport. The cytosolic precursor of the COPI coat, the heptameric coatomer complex, is composed of two subcomplexes. The first consists of the COPB, COPG, COPD and COPZ1 subunits (also known as beta-COP, gamma-COP, delta-COP and zeta-1 COP, respectively), which are distantly homologous to AP Clathrin adaptor subunits. The second consists of the COPA, COPP and COPE subunits (also known as alpha-COP, COPP and episilon-COP, respectively).

Alternate Names

CGI-120, coatomer protein complex, subunit zeta, coatomer protein complex, subunit zeta 1, coatomer subunit zeta-1, COPZ, Zeta-1 COP, Zeta-1-coat protein, zeta1-COP

Gene Symbol

COPZ1

Additional COPZ1 Products

Product Documents for COPZ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COPZ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COPZ1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COPZ1 Antibody - BSA Free and earn rewards!

Have you used COPZ1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...