COQ5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-82738
Loading...
Key Product Details
Species Reactivity
Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ5. Peptide sequence: RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGI The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Mouse reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for COQ5 Antibody - BSA Free
Western Blot: COQ5 Antibody [NBP2-82738]
Western Blot: COQ5 Antibody [NBP2-82738] - WB Suggested Anti-Coq5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat LungWestern Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-82738] -
Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-82738] - Analysis of Rabbit Polyclonal COQ5 Antibody using mouse liver tissue. A band at the expected molecular weight (about 37kDa) is observed. Technical data: Blocking in milk. Primary antibody dilution: 1:500. Secondary antibody dilution: 1:2500. Image from a verified customer review.Applications for COQ5 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 4 using NBP2-82738 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: COQ5
Alternate Names
coenzyme Q5 homolog, methyltransferase (S. cerevisiae), coenzyme Q5 homolog, methyltransferase (yeast), EC 2.1.1, EC 2.1.1.-, EC 2.1.1.52, MGC104303, MGC4767, ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
Gene Symbol
COQ5
Additional COQ5 Products
Product Documents for COQ5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for COQ5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for COQ5 Antibody - BSA Free
Customer Reviews for COQ5 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used COQ5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Liver tissue and LiverSpecies: MouseVerified Customer | Posted 04/08/2024A band at the expected molecular weight (about 37kDa) is observed, so we can confirm that this antibody is useful in mice. Technical data: Blocking in milk. Primary antibody dilution: 1:500. Secondary antibody dilution: 1:2500.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...