CPSF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57114

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CPSF4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CPSF4(cleavage and polyadenylation specific factor 4, 30kDa) The peptide sequence was selected from the C terminal of CPSF4. Peptide sequence SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 4.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CPSF4 Antibody - BSA Free

Western Blot: CPSF4 Antibody [NBP1-57114]

Western Blot: CPSF4 Antibody [NBP1-57114]

Western Blot: CPSF4 Antibody [NBP1-57114] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for CPSF4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPSF4

Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.

Alternate Names

30kD, cleavage and polyadenylation specific factor 4, 30kD subunit, cleavage and polyadenylation specific factor 4, 30kDa, CPSF 30 kDa subunit, neb-1, No arches homolog, no arches-like zinc finger protein, NS1 effector domain-binding protein 1

Gene Symbol

CPSF4

Additional CPSF4 Products

Product Documents for CPSF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CPSF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPSF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPSF4 Antibody - BSA Free and earn rewards!

Have you used CPSF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies