Cyclin G2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79935

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human CCNG2. Peptide sequence MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cyclin G2 Antibody - BSA Free

Western Blot: Cyclin G2 Antibody [NBP1-79935]

Western Blot: Cyclin G2 Antibody [NBP1-79935]

Western Blot: Cyclin G2 Antibody [NBP1-79935] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: Cyclin G2 Antibody [NBP1-79935]

Western Blot: Cyclin G2 Antibody [NBP1-79935]

Western Blot: Cyclin G2 Antibody [NBP1-79935] - Jurkat Cell Lysate 2.5ug/ml; Gel Concentration: 12%

Applications for Cyclin G2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cyclin G2

The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.

Alternate Names

cyclin G2, cyclin-G2

Gene Symbol

CCNG2

Additional Cyclin G2 Products

Product Documents for Cyclin G2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cyclin G2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cyclin G2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cyclin G2 Antibody - BSA Free and earn rewards!

Have you used Cyclin G2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Cyclin G2 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: Does this antibody work for pigs?

    A: We have not yet tested our Cyclin G2 antibody NBP1-79935 for cross reactivity with the porcine protein yet. The immunogen sequence does share about 90% similarity to the uncharacterized porcine sequence http://www.uniprot.org/uniprot/F1RYS3, so there is a good chance the antibody will detect the pig protein.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...