CYP4B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69677

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CYP4B1(cytochrome P450, family 4, subfamily B, polypeptide 1) The peptide sequence was selected from the N terminal of CYP4B1. Peptide sequence SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CYP4B1 Antibody - BSA Free

Western Blot: CYP4B1 Antibody [NBP1-69677]

Western Blot: CYP4B1 Antibody [NBP1-69677]

Western Blot: CYP4B1 Antibody [NBP1-69677] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: CYP4B1 Antibody [NBP1-69677]

Western Blot: CYP4B1 Antibody [NBP1-69677]

Western Blot: CYP4B1 Antibody [NBP1-69677] - This Anti-CYP4B1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.
Western Blot: CYP4B1 Antibody [NBP1-69677]

Western Blot: CYP4B1 Antibody [NBP1-69677]

Western Blot: CYP4B1 Antibody [NBP1-69677] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Applications for CYP4B1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP4B1

CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined. Two transcript variants encoding slightly different isoforms have been found for this gene.

Alternate Names

CYPIVB1, cytochrome P450 4B1, cytochrome P450, family 4, subfamily B, polypeptide 1, cytochrome P450, subfamily IVB, polypeptide 1, Cytochrome P450-HP, EC 1.14.14.1, microsomal monooxygenase, P-450HP

Gene Symbol

CYP4B1

UniProt

Additional CYP4B1 Products

Product Documents for CYP4B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP4B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP4B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP4B1 Antibody - BSA Free and earn rewards!

Have you used CYP4B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...