Cytohesin 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56913

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytohesin 4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytohesin 4 Antibody - BSA Free

Western Blot: Cytohesin 4 Antibody [NBP1-56913]

Western Blot: Cytohesin 4 Antibody [NBP1-56913]

Western Blot: Cytohesin 4 Antibody [NBP1-56913] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for Cytohesin 4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytohesin 4

PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.

Alternate Names

CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1

Gene Symbol

CYTH4

UniProt

Q9UIA0 (Human)

Additional Cytohesin 4 Products

Product Documents for Cytohesin 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytohesin 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytohesin 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytohesin 4 Antibody - BSA Free and earn rewards!

Have you used Cytohesin 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies