Cytokeratin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69045

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to KRT3 (keratin 3) The peptide sequence was selected from the C terminal of KRT3. Peptide sequence GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytokeratin 3 Antibody - BSA Free

Western Blot: Cytokeratin 3 Antibody [NBP1-69045]

Western Blot: Cytokeratin 3 Antibody [NBP1-69045]

Western Blot: Cytokeratin 3 Antibody [NBP1-69045] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for Cytokeratin 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytokeratin 3

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmann's Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Alternate Names

CK3, CK-3, Cytokeratin-3, FLJ95909, K3cytokeratin 3, keratin 3, keratin, type II cytoskeletal 3,65 kDa cytokeratin, Keratin-3, Type-II keratin Kb3

Gene Symbol

KRT3

Additional Cytokeratin 3 Products

Product Documents for Cytokeratin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytokeratin 3 Antibody - BSA Free and earn rewards!

Have you used Cytokeratin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...