DAZAP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87246

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DAZAP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DAZAP2. Peptide sequence: AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DAZAP2 Antibody - BSA Free

Western Blot: DAZAP2 Antibody [NBP2-87246]

Western Blot: DAZAP2 Antibody [NBP2-87246]

Western Blot: DAZAP2 Antibody [NBP2-87246] - WB Suggested Anti-DAZAP2 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole cellDAZAP2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Applications for DAZAP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DAZAP2

DAZAP2, also known as DAZ-associated protein2, consists of five isoforms of sizes 17.3 kDa, 16.1 kDa, 14 kDa, 9 kDa, and 22.8 kDa and is involved in interactions with DAZ proteins and transforming growth factor signaling molecules. This protein is being studied for connection to disorders and diseases such as multiple myeloma, brachydactyly, ataxia, prostatitis, and azoospermia. The protein interacts in pathways including cell signaling, transcription regulation, spermatogenesis, and RNA splicing, which also involve POLI, RHOXF2, BATF2, EXD3, and ZFAND2B proteins.

Alternate Names

DAZ associated protein 2, deleted in azoospermia associated protein 2, Deleted in azoospermia-associated protein 2, KIAA0058DAZ-associated protein 2, MGC14319, MGC766, proline-rich transcript in brain, proline-rich transcript, brain-expressed protein, PRTB

Gene Symbol

DAZAP2

Additional DAZAP2 Products

Product Documents for DAZAP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DAZAP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAZAP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAZAP2 Antibody - BSA Free and earn rewards!

Have you used DAZAP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies