DDIT4L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55005

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDIT4L Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DDIT4L(DNA-damage-inducible transcript 4-like) The peptide sequence was selected from the middle region of DDIT4L (NP_660287). Peptide sequence ESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DDIT4L Antibody - BSA Free

Western Blot: DDIT4L Antibody [NBP1-55005]

Western Blot: DDIT4L Antibody [NBP1-55005]

Western Blot: DDIT4L Antibody [NBP1-55005] - 293T Whole Cell lysates, Antibody Dilution: 0.1 ug/ml.
Western Blot: DDIT4L Antibody [NBP1-55005]

Western Blot: DDIT4L Antibody [NBP1-55005]

Western Blot: DDIT4L Antibody [NBP1-55005] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: DDIT4L Antibody [NBP1-55005]

Western Blot: DDIT4L Antibody [NBP1-55005]

Western Blot: DDIT4L Antibody [NBP1-55005] - 293T Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

Applications for DDIT4L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDIT4L

DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

Alternate Names

DNA damage-inducible transcript 4-like protein, DNA-damage-inducible transcript 4-like, HIF-1 responsive protein RTP801-like, homolog of mouse SMHS1, Protein regulated in development and DNA damage response 2, REDD-2, REDD2Rtp801L, regulated in development and DNA damage response 2, RTP801L

Entrez Gene IDs

115265 (Human)

Gene Symbol

DDIT4L

UniProt

Q96D03 (Human)

Additional DDIT4L Products

Product Documents for DDIT4L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDIT4L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDIT4L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDIT4L Antibody - BSA Free and earn rewards!

Have you used DDIT4L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies