DDX42 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57335

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to DDX42 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 42) The peptide sequence was selected from the N terminal of DDX42 (NP_031398). Peptide sequence PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DDX42 Antibody - BSA Free

Western Blot: DDX42 Antibody [NBP1-57335]

Western Blot: DDX42 Antibody [NBP1-57335]

Western Blot: DDX42 Antibody [NBP1-57335] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Applications for DDX42 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX42

DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX42 is a ATP-dependent RNA helicase. DDX42 binds to partially double-stranded RNAs (dsRNAs) in order to unwind RNA secondary structures. It also mediates RNA duplex formation thereby displacing the single-strand RNA binding protein.This gene encodes a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encoding the same protein have been identified for this gene.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, DEAD box protein 42, EC 3.6.1, EC 3.6.4.13, RHELPSF3b DEAD box protein, RNA helicase-like protein, RNA helicase-related protein, RNAHPFLJ43179, SF3b125 DEAD-box protein, SF3b125ATP-dependent RNA helicase DDX42, Splicing factor 3B-associated 125 kDa protein

Entrez Gene IDs

11325 (Human)

Gene Symbol

DDX42

UniProt

Additional DDX42 Products

Product Documents for DDX42 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX42 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX42 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX42 Antibody - BSA Free and earn rewards!

Have you used DDX42 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...