Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55231

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dehydrodolichyl Diphosphate Synthase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231]

Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231]

Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dehydrodolichyl Diphosphate Synthase

Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-301 BX648507.1 32-332 302-886 AB090852.1 192-776 887-2199 AK023164.1 846-2158 2200-2425 BX648507.1 2251-2476 2426-3011 AK023164.1 2387-2972 3012-3257 BX648507.1 3063-3308 3258-3315 BQ028814.1 1-58 c

Alternate Names

cis-isoprenyltransferase, cis-prenyl transferase, CIT, CPT, Dedol-PP synthase, dehydrodolichyl diphosphate synthase, EC 2.5.1.-, FLJ13102, HDSDS

Gene Symbol

DHDDS

UniProt

Q86SQ9 (Human)

Additional Dehydrodolichyl Diphosphate Synthase Products

Product Documents for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free and earn rewards!

Have you used Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies