Derlin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84780

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Derlin-2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Derlin-2. Peptide sequence: IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Derlin-2 Antibody - BSA Free

Western Blot: Derlin-2 Antibody [NBP2-84780]

Western Blot: Derlin-2 Antibody [NBP2-84780]

Western Blot: Derlin-2 Antibody [NBP2-84780] - Host: Rabbit. Target Name: DERL2. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for Derlin-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Derlin-2

DERL2 (Derlin 2) may be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. Its precise role is however unclear. In contrast to DER1, it is not involved in the degradation of MHC class I heavy chains in cas of infection by the cytomegalovirus. DERL2 may play a role in cell proliferation.

Alternate Names

carcinoma related, Degradation in endoplasmic reticulum protein 2, Der1-like domain family, member 2, Der1-like protein 2, DER2, derlin-2, F-LAN-1DERtrin-2, FLANa, F-LANaCGI-101

Gene Symbol

DERL2

Additional Derlin-2 Products

Product Documents for Derlin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Derlin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Derlin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Derlin-2 Antibody - BSA Free and earn rewards!

Have you used Derlin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies