Derlin-3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59467

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to Derlin-3 (Der1-like domain family, member 3) The peptide sequence was selected from the C terminal of Derlin-3 (NP_001002862). Peptide sequence YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Derlin-3 Antibody - BSA Free

Western Blot: Derlin-3 Antibody [NBP1-59467]

Western Blot: Derlin-3 Antibody [NBP1-59467]

Western Blot: Derlin-3 Antibody [NBP1-59467] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for Derlin-3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Derlin-3

DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL3 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM].

Alternate Names

C22orf14, chromosome 22 open reading frame 14, Degradation in endoplasmic reticulum protein 3, Der1-like domain family, member 3, Der1-like protein 3, DER3, derlin 3, derlin-3, DERtrin 3, DERtrin-3, FLJ43842, IZP6, LLN2, MGC71803

Entrez Gene IDs

91319 (Human); 70377 (Mouse); 614334 (Bovine)

Gene Symbol

DERL3

UniProt

Additional Derlin-3 Products

Product Documents for Derlin-3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Derlin-3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Derlin-3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Derlin-3 Antibody - BSA Free and earn rewards!

Have you used Derlin-3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...