DGK-delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87266

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DGK-delta. Peptide sequence: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DGK-delta Antibody - BSA Free

Western Blot: DGK-delta Antibody [NBP2-87266]

Western Blot: DGK-delta Antibody [NBP2-87266]

Western Blot: DGK-delta Antibody [NBP2-87266] - WB Suggested Anti-DGKD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell

Applications for DGK-delta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DGK-delta

Diacylglycerol kinases (DGKs) phosphorylate diacylglycerol (DAG) to produce phosphatidic acid. DAG and phosphatidic acid are lipids that act as second messengers in signaling cascades. DGK-alpha influences cell activation and secretion of lethal exosomes, which in turn control cell death. DGK-beta is abundant in restricted brain regions such as the caudate putamen and olfactory tubercle. DGK-gamma encodes full-length and truncated transcripts that are present in a range of human tissues, with greatest expression observed in retina. DGK-delta is most abundant in skeletal muscle. DGK-episilon shows specificity for arachidonylcontaining diacylglycerol and is expressed predominantly in testis. DGK-theta is most abundant in the cerebellum and hippocampus. DGK-iota is present in brain and retina as a predominant transcript of more than 12 kb, including a long 3-prime untranslated region, with additional low abundance transcripts of 9.5 and 7.5 kb. DGK-eta is closely related to DGK-delta. DGK-zeta is most abundant in brain and muscle. DGKs have structural motifs that play regulatory roles, and these motifs form the basis for dividing the DGKs into five subtypes.

Long Name

Diacylglycerol Kinase, delta 130 kDa

Alternate Names

DGKD, DGKdelta

Gene Symbol

DGKD

Additional DGK-delta Products

Product Documents for DGK-delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DGK-delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DGK-delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGK-delta Antibody - BSA Free and earn rewards!

Have you used DGK-delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...