DIRAS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86617

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DIRAS2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DIRAS2. Peptide sequence: TSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DIRAS2 Antibody - BSA Free

Western Blot: DIRAS2 Antibody [NBP2-86617]

Western Blot: DIRAS2 Antibody [NBP2-86617]

Western Blot: DIRAS2 Antibody [NBP2-86617] - Host: Rabbit. Target Name: DIRAS2. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for DIRAS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DIRAS2

DIRAS2, also known as GTP-binding protein Di-Ras2, consists of a 199 amino acid isoform that is 22 kDa, and is located in the cell membrane of brain cells, though its specific function is unknown. There is no current disease research involving DIRAS2. DIRAS2 has been linked to GTPase mediated signal transduction, through which it interacts with CALM1, CALM2, CALM3, MYC, and YWHAB.

Alternate Names

DIRAS family, GTP-binding RAS-like 2, Di-Ras2, Distinct subgroup of the Ras family member 2, DKFZp761C07121, GTP-binding protein Di-Ras2

Gene Symbol

DIRAS2

Additional DIRAS2 Products

Product Documents for DIRAS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DIRAS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DIRAS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DIRAS2 Antibody - BSA Free and earn rewards!

Have you used DIRAS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies