DLG7/HURP Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-24790PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all DLG7/HURP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLG7/HURP

Source: E.coli

Amino Acid Sequence: QTRLLMKERFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24790It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-24790PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DLG7/HURP

DLG7/HURP is a novel component of the Ran-importin spindle assembly pathway. DLG7/HURP binds microtubules and affects their organization both in vitro and in vivo. In egg extract, anti-DLG7/HURP antibodies disrupt the formation of both Ran-dependent and chromatin and centrosome-induced spindles. DLG7/HURP is also required for the proper formation and function of mitotic spindles in HeLa cells. DLG7/HURP is also over-expressed in some tumor types

Alternate Names

DAP-5, Discs large homolog 7, discs, large (Drosophila) homolog-associated protein 5, disks large-associated protein 5, DLG7, Hepatoma up-regulated protein, HURPDLG1, KIAA0008discs, large homolog 7 (Drosophila), large homolog 7

Gene Symbol

DLGAP5

Additional DLG7/HURP Products

Product Documents for DLG7/HURP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DLG7/HURP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for DLG7/HURP Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review DLG7/HURP Recombinant Protein Antigen and earn rewards!

Have you used DLG7/HURP Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes