DMBT1/GP340 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57668

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to DMBT1(deleted in malignant brain tumors 1) Antibody(against the N terminal of DMBT1. Peptide sequence SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DMBT1/GP340 Antibody - BSA Free

Western Blot: DMBT1/GP340 Antibody [NBP1-57668]

Western Blot: DMBT1/GP340 Antibody [NBP1-57668]

Western Blot: DMBT1/GP340 Antibody [NBP1-57668] - Human Stomach, concentration 0.2-1 ug/ml.
Western Blot: DMBT1/GP340 Antibody [NBP1-57668]

Western Blot: DMBT1/GP340 Antibody [NBP1-57668]

Western Blot: DMBT1/GP340 Antibody [NBP1-57668] - Lanes: Lane 1 : 2ug MCF7-DMBT1+Dox Lane 2: 2ug MCF7-DMBT1 -Dox Lane 3: 2ug MCF7-Ctrl+Dox Lane 4: 2ug MCF7-DMBT1 -Dox Primary, Antibody Dilution: 1 : 5000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 10,000 Gene name: DMBT1.

Applications for DMBT1/GP340 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DMBT1

Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

Long Name

Deleted in Malignant Brain Tumors 1

Alternate Names

CRP-ductin, Ebnerin, GP340, Hensin, Muclin, SAG, Vomeroglandin

Gene Symbol

DMBT1

UniProt

Additional DMBT1 Products

Product Documents for DMBT1/GP340 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DMBT1/GP340 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DMBT1/GP340 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DMBT1/GP340 Antibody - BSA Free and earn rewards!

Have you used DMBT1/GP340 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...