DMRT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82870

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DMRT2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse DMRT2. Peptide sequence: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DMRT2 Antibody - BSA Free

Western Blot: DMRT2 Antibody [NBP2-82870]

Western Blot: DMRT2 Antibody [NBP2-82870]

Western Blot: DMRT2 Antibody [NBP2-82870] - WB Suggested Anti-DMRT2 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:1562500. Positive Control: SP2/0 cell lysate

Applications for DMRT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DMRT2

DMRT2, also known as Doublesex and mab-3-related transcription factor 2, consists of a 61.8 kDa, a 24.5 kDa, and a 36.9 kDa isoform and is involved in regulating activation of the gene MYF5 as a transcription factor during embryogenesis and somite development. Current research has linked the protein to diseases such as sex reversal, attention deficit hyperactivity disorder, leukemia, anemia, and gonadal dysgenesis. The protein interacts with UBC, CCDC18, BCLAF1, RPS3, and MYBBP1A in transcription pathways.

Alternate Names

doublesex and mab-3 related transcription factor 2, doublesex- and mab-3-related transcription factor 2, Doublesex-like 2 protein, DSXL2, DSXL-2, terra-like protein

Gene Symbol

DMRT2

Additional DMRT2 Products

Product Documents for DMRT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DMRT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DMRT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DMRT2 Antibody - BSA Free and earn rewards!

Have you used DMRT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies