DPP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59427

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to DPP6(dipeptidyl-peptidase 6) The peptide sequence was selected from the middle region of DPP6. Peptide sequence FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DPP6 Antibody - BSA Free

Western Blot: DPP6 Antibody [NBP1-59427]

Western Blot: DPP6 Antibody [NBP1-59427]

Western Blot: DPP6 Antibody [NBP1-59427] - Lanes: Lane 1: 20 ug mouse WT brain extract Lnae 2: DPP6 -/- mouse brain extract Lane 3: 20 ug mouse WT brain extract 4: DPP6 -/- mouse brain extract Primary Antibody Dilution: 1:1000 Secondary Antibody: Donkey anti-rabbit-HRP Secondary Antibody Dilution:
Western Blot: DPP6 Antibody [NBP1-59427]

Western Blot: DPP6 Antibody [NBP1-59427]

Western Blot: DPP6 Antibody [NBP1-59427] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for DPP6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPP6

DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Long Name

Dipeptidyl-peptidase 6

Alternate Names

DPPX

Gene Symbol

DPP6

UniProt

Additional DPP6 Products

Product Documents for DPP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DPP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DPP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPP6 Antibody - BSA Free and earn rewards!

Have you used DPP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...